GPD1 anticorps

N° du produit ABIN631716

Cet anticorps anti-GPD1 est un anticorps Lapin Polyclonal détectant GPD1 dans WB. Adapté pour Humain.

Aperçu rapide pour GPD1 anticorps (ABIN631716)

Antigène: GPD1 (Glycerol-3-Phosphate Dehydrogenase 1 (Soluble) (GPD1))

Reactivité: Humain

Hôte: Lapin

Clonalité: Polyclonal

Conjugué: Cet anticorp GPD1 est non-conjugé

Application: Western Blotting (WB)

Détail du produit anti-GPD1 anticorps

Purification: Affinity purified

Immunogène: GPD1 antibody was raised using a synthetic peptide corresponding to a region with amino acids TFLESCGVADLITTCYGGRNRKVAEAFARTGKSIEQLEKELLNGQKLQGP

Information d'application

Indications d'application: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Commentaires:

GPD1 Blocking Peptide, (ABIN5613829), is also available for use as a blocking control in assays to test for specificity of this GPD1 antibody

Restrictions: For Research Use only

Stockage

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of GPD1 antibody in PBS

Concentration: Lot specific

Buffer: PBS

Conseil sur la manipulation: Avoid repeated freeze/thaw cycles.

Stock: 4 °C/-20 °C

Stockage commentaire: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Détails sur GPD1

Antigène: GPD1 (Glycerol-3-Phosphate Dehydrogenase 1 (Soluble) (GPD1))

Autre désignation: GPD1

Sujet: GPD1L belongs to the NAD-dependent glycerol-3-phosphate dehydrogenase family. Defects in GPD1L are the cause of Brugada syndrome type 2 (BRS2) and sudden infant death syndrome (SIDS).

Poids moléculaire: 37 kDa (MW of target protein)